BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 133355|92 (459 letters) Database: Oryza sativa pep 62,827 sequences; 28,532,038 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value LOC_Os09g30340.1|11979.m06185|protein Photosystem I reaction cen... 184 4e-47 >LOC_Os09g30340.1|11979.m06185|protein Photosystem I reaction center subunit V, chloroplast precursor, putative, expressed Length = 141 Score = 184 bits (467), Expect = 4e-47 Identities = 88/101 (87%), Positives = 96/101 (95%) Frame = +2 Query: 2 ARAALEPSVVISLSTGLSLVMGRFVFFNFQRENVAKQVPEQNGKTHFEAGDERAKEFAGI 181 ARA L PS+VISLSTG+SL +GRFVFFNFQRENVAKQVPEQNGKTHF+AGDERAKEFAG+ Sbjct: 41 ARAELSPSLVISLSTGVSLFLGRFVFFNFQRENVAKQVPEQNGKTHFDAGDERAKEFAGL 100 Query: 182 LKSNDPVGFNLVDVLAWGSIGHIVAYYILATTSNGYDPPFF 304 L+SNDPVGFNLVDVLAWGS+GHIVAYYILAT SNGY+P FF Sbjct: 101 LRSNDPVGFNLVDVLAWGSLGHIVAYYILATCSNGYNPNFF 141 Database: Oryza sativa pep Posted date: May 20, 2006 10:31 AM Number of letters in database: 28,532,038 Number of sequences in database: 62,827 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,427,739 Number of Sequences: 62827 Number of extensions: 360372 Number of successful extensions: 1251 Number of sequences better than 1.0e-08: 1 Number of HSP's better than 0.0 without gapping: 1217 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1251 length of database: 28,532,038 effective HSP length: 96 effective length of database: 22,500,646 effective search space used: 1260036176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
