Blast Search against Oryza sativa pep on 09-MAR-07

LOC_Os02g44630.3|11972.m33811|proteinLOC_Os02g44630.1|11972.m09503|proteinLOC_Os04g47220.1|11974.m09668|proteinLOC_Os02g57720.1|11972.m10793|proteinLOC_Os07g26640.1|11977.m06942|proteinLOC_Os07g26630.1|11977.m06941|proteinLOC_Os04g44060.1|11974.m09364|proteinLOC_Os07g26690.1|11977.m06946|proteinLOC_Os02g41860.1|11972.m09223|proteinLOC_Os04g16450.1|11974.m06823|protein
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 132649|472
         (466 letters)

Database: Oryza sativa pep 
           62,827 sequences; 28,532,038 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

LOC_Os02g44630.3|11972.m33811|protein Aquaporin RWC3, putative, ...   125   2e-29
LOC_Os02g44630.1|11972.m09503|protein Aquaporin RWC3, putative, ...   125   2e-29
LOC_Os04g47220.1|11974.m09668|protein Aquaporin RWC3, putative, ...   121   4e-28
LOC_Os02g57720.1|11972.m10793|protein Aquaporin RWC3, putative, ...   116   1e-26
LOC_Os07g26640.1|11977.m06942|protein Aquaporin PIP2.2, putative...   100   6e-22
LOC_Os07g26630.1|11977.m06941|protein Aquaporin PIP2.2, putative...   100   8e-22
LOC_Os04g44060.1|11974.m09364|protein Aquaporin PIP2.2, putative...   100   1e-21
LOC_Os07g26690.1|11977.m06946|protein aquaporin PIP2.4, putative...    99   2e-21
LOC_Os02g41860.1|11972.m09223|protein Aquaporin PIP2.2, putative...    99   3e-21
LOC_Os04g16450.1|11974.m06823|protein aquaporin PIP2.8, putative...    97   7e-21

>LOC_Os02g44630.3|11972.m33811|protein Aquaporin RWC3, putative,
           expressed
          Length = 214

 Score =  125 bits (314), Expect = 2e-29
 Identities = 59/62 (95%), Positives = 61/62 (98%)
 Frame = -1

Query: 466 TIPITGTGINPARSLGAAIIYNRDHAWNDHWIFWVGPFVGAALAAVYHQVIIRAIPFNKS 287
           TIPITGTGINPARSLGAAIIYN+DHAWNDHWIFWVGPFVGAALAA+YHQVIIRAIPF KS
Sbjct: 154 TIPITGTGINPARSLGAAIIYNKDHAWNDHWIFWVGPFVGAALAAIYHQVIIRAIPF-KS 212

Query: 286 RS 281
           RS
Sbjct: 213 RS 214


>LOC_Os02g44630.1|11972.m09503|protein Aquaporin RWC3, putative,
           expressed
          Length = 289

 Score =  125 bits (314), Expect = 2e-29
 Identities = 59/62 (95%), Positives = 61/62 (98%)
 Frame = -1

Query: 466 TIPITGTGINPARSLGAAIIYNRDHAWNDHWIFWVGPFVGAALAAVYHQVIIRAIPFNKS 287
           TIPITGTGINPARSLGAAIIYN+DHAWNDHWIFWVGPFVGAALAA+YHQVIIRAIPF KS
Sbjct: 229 TIPITGTGINPARSLGAAIIYNKDHAWNDHWIFWVGPFVGAALAAIYHQVIIRAIPF-KS 287

Query: 286 RS 281
           RS
Sbjct: 288 RS 289


>LOC_Os04g47220.1|11974.m09668|protein Aquaporin RWC3, putative,
           expressed
          Length = 282

 Score =  121 bits (303), Expect = 4e-28
 Identities = 56/62 (90%), Positives = 60/62 (96%)
 Frame = -1

Query: 466 TIPITGTGINPARSLGAAIIYNRDHAWNDHWIFWVGPFVGAALAAVYHQVIIRAIPFNKS 287
           TIPITGTGINPARSLGAAIIYNR HAW+DHWIFWVGPF+GAALAA+YHQV+IRAIPF KS
Sbjct: 222 TIPITGTGINPARSLGAAIIYNRGHAWDDHWIFWVGPFIGAALAAIYHQVVIRAIPF-KS 280

Query: 286 RS 281
           RS
Sbjct: 281 RS 282


>LOC_Os02g57720.1|11972.m10793|protein Aquaporin RWC3, putative,
           expressed
          Length = 288

 Score =  116 bits (290), Expect = 1e-26
 Identities = 53/61 (86%), Positives = 58/61 (95%)
 Frame = -1

Query: 466 TIPITGTGINPARSLGAAIIYNRDHAWNDHWIFWVGPFVGAALAAVYHQVIIRAIPFNKS 287
           TIPITGTGINPARSLGAAI+YNR HAW+DHWIFWVGPF+GAALAA+YH V+IRAIPF KS
Sbjct: 228 TIPITGTGINPARSLGAAIVYNRAHAWHDHWIFWVGPFIGAALAAIYHVVVIRAIPF-KS 286

Query: 286 R 284
           R
Sbjct: 287 R 287


>LOC_Os07g26640.1|11977.m06942|protein Aquaporin PIP2.2, putative,
           expressed
          Length = 223

 Score =  100 bits (250), Expect = 6e-22
 Identities = 43/54 (79%), Positives = 50/54 (92%)
 Frame = -1

Query: 466 TIPITGTGINPARSLGAAIIYNRDHAWNDHWIFWVGPFVGAALAAVYHQVIIRA 305
           TIPITGTGINPARSLGAA++YN   AW+D WIFWVGPF+GAA+AA+YHQVI+RA
Sbjct: 158 TIPITGTGINPARSLGAAVMYNNSKAWSDQWIFWVGPFIGAAIAALYHQVILRA 211


>LOC_Os07g26630.1|11977.m06941|protein Aquaporin PIP2.2, putative,
           expressed
          Length = 286

 Score =  100 bits (249), Expect = 8e-22
 Identities = 42/54 (77%), Positives = 50/54 (92%)
 Frame = -1

Query: 466 TIPITGTGINPARSLGAAIIYNRDHAWNDHWIFWVGPFVGAALAAVYHQVIIRA 305
           TIPITGTGINPARSLG A++YN + AW+D WIFWVGPF+GAA+AA+YHQVI+RA
Sbjct: 221 TIPITGTGINPARSLGVAVVYNNNKAWSDQWIFWVGPFIGAAIAALYHQVILRA 274


>LOC_Os04g44060.1|11974.m09364|protein Aquaporin PIP2.2, putative,
           expressed
          Length = 290

 Score =  100 bits (248), Expect = 1e-21
 Identities = 42/54 (77%), Positives = 49/54 (90%)
 Frame = -1

Query: 466 TIPITGTGINPARSLGAAIIYNRDHAWNDHWIFWVGPFVGAALAAVYHQVIIRA 305
           TIPITGTGINPARSLGAA+IYN+  AW+DHWIFWVGP +GAA+AA YHQ ++RA
Sbjct: 224 TIPITGTGINPARSLGAAVIYNQHKAWHDHWIFWVGPLIGAAIAAAYHQYVLRA 277


>LOC_Os07g26690.1|11977.m06946|protein aquaporin PIP2.4, putative,
           expressed
          Length = 290

 Score = 99.4 bits (246), Expect = 2e-21
 Identities = 42/54 (77%), Positives = 50/54 (92%)
 Frame = -1

Query: 466 TIPITGTGINPARSLGAAIIYNRDHAWNDHWIFWVGPFVGAALAAVYHQVIIRA 305
           TIPITGTGINPARS+GAA+I+N + AW++HWIFWVGPFVGAA+AA YHQ I+RA
Sbjct: 224 TIPITGTGINPARSIGAAVIFNNEKAWHNHWIFWVGPFVGAAIAAFYHQYILRA 277


>LOC_Os02g41860.1|11972.m09223|protein Aquaporin PIP2.2, putative,
           expressed
          Length = 288

 Score = 98.6 bits (244), Expect = 3e-21
 Identities = 41/54 (75%), Positives = 48/54 (88%)
 Frame = -1

Query: 466 TIPITGTGINPARSLGAAIIYNRDHAWNDHWIFWVGPFVGAALAAVYHQVIIRA 305
           TIPITGTGINPARSLG A+IYN+D AW+D WIFWVGP +GAA+AA YHQ ++RA
Sbjct: 223 TIPITGTGINPARSLGTAVIYNKDKAWDDQWIFWVGPLIGAAIAAAYHQYVLRA 276


>LOC_Os04g16450.1|11974.m06823|protein aquaporin PIP2.8, putative,
           expressed
          Length = 282

 Score = 97.4 bits (241), Expect = 7e-21
 Identities = 41/54 (75%), Positives = 47/54 (87%)
 Frame = -1

Query: 466 TIPITGTGINPARSLGAAIIYNRDHAWNDHWIFWVGPFVGAALAAVYHQVIIRA 305
           TIPITGTGINPARS+GAA+IYN+  AW+DHWIFW GPF+GA  AA YHQ I+RA
Sbjct: 214 TIPITGTGINPARSIGAAVIYNQKKAWDDHWIFWAGPFIGALAAAAYHQYILRA 267


  Database: Oryza sativa pep
    Posted date:  May 20, 2006 10:31 AM
  Number of letters in database: 28,532,038
  Number of sequences in database:  62,827
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 26,864,852
Number of Sequences: 62827
Number of extensions: 677517
Number of successful extensions: 2627
Number of sequences better than 1.0e-08: 10
Number of HSP's better than  0.0 without gapping: 2423
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2580
length of database: 28,532,038
effective HSP length: 96
effective length of database: 22,500,646
effective search space used: 1305037468
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)