BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 141349|479 (414 letters) Database: Oryza sativa pep 62,827 sequences; 28,532,038 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value LOC_Os09g39400.1|11979.m06878|protein Histidine-containing phosp... 87 7e-18 LOC_Os08g44350.1|11978.m08408|protein Hpt domain containing prot... 80 8e-16 >LOC_Os09g39400.1|11979.m06878|protein Histidine-containing phosphotransfer protein 1, putative, expressed Length = 149 Score = 87.0 bits (214), Expect = 7e-18 Identities = 41/58 (70%), Positives = 51/58 (87%) Frame = -1 Query: 414 SSSVGAQKVKLACMHFRQFYEAKSKDGCLMALALVRSEFCDVRSKFQTMMQLGQQIEA 241 S+SVGAQKVK CM FRQF + KS+DGCLMALA+VR++F D+R+KFQTM+QL QQI+A Sbjct: 86 SASVGAQKVKFTCMQFRQFCQDKSRDGCLMALAVVRNDFYDLRNKFQTMLQLEQQIQA 143 >LOC_Os08g44350.1|11978.m08408|protein Hpt domain containing protein, expressed Length = 147 Score = 80.1 bits (196), Expect = 8e-16 Identities = 37/59 (62%), Positives = 48/59 (81%) Frame = -1 Query: 414 SSSVGAQKVKLACMHFRQFYEAKSKDGCLMALALVRSEFCDVRSKFQTMMQLGQQIEAC 238 S+SVGAQKVK C+ FR+F + +S+DGCL L LVR+EF D+R+KFQ M+QL QQI+AC Sbjct: 85 SASVGAQKVKNTCIQFREFCQQRSRDGCLKTLDLVRTEFYDLRNKFQAMLQLEQQIQAC 143 Database: Oryza sativa pep Posted date: May 20, 2006 10:31 AM Number of letters in database: 28,532,038 Number of sequences in database: 62,827 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,161,274 Number of Sequences: 62827 Number of extensions: 520690 Number of successful extensions: 1373 Number of sequences better than 1.0e-08: 2 Number of HSP's better than 0.0 without gapping: 1349 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1373 length of database: 28,532,038 effective HSP length: 94 effective length of database: 22,626,300 effective search space used: 972930900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
